PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.189540.1
Common NameCsa_2G100550, LOC101221134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 265aa    MW: 29982.8 Da    PI: 8.855
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.189540.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.6e-161156147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ed +l+++v ++G+ +W++Ia+++  gR++k+c++rw++ 
   Cucsa.189540.1 11 RGHWRPAEDTKLKELVGLYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 56
                     899*****************************.***********996 PP

2Myb_DNA-binding57.14.3e-1863107147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+++T+eE+e+l +a++++G++ W+ Iar ++ gRt++ +k++w+ +
   Cucsa.189540.1  63 RKAFTEEEEERLMQAHEMYGNK-WAMIARLFP-GRTDNGVKNHWHVV 107
                      789*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.236657IPR017930Myb domain
SMARTSM007171.7E-131059IPR001005SANT/Myb domain
SuperFamilySSF466892.13E-2811104IPR009057Homeodomain-like
PfamPF002492.8E-151156IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-251264IPR009057Homeodomain-like
CDDcd001675.54E-121455No hitNo description
PROSITE profilePS5129426.02658112IPR017930Myb domain
SMARTSM007177.6E-1462110IPR001005SANT/Myb domain
PfamPF002495.4E-1563106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2165111IPR009057Homeodomain-like
CDDcd001671.71E-1065108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MAASKSKVCG RGHWRPAEDT KLKELVGLYG PQNWNLIAEK LEGRSGKSCR LRWFNQLDPR  60
INRKAFTEEE EERLMQAHEM YGNKWAMIAR LFPGRTDNGV KNHWHVVMAR NCRQHFSSYR  120
RSSRNLTHSL SIASSALPTP PLPPTRSLSR PNHLPFHLLP RPGSETSNEM EVISSYSCNK  180
TSSNHENQTC NNIHYCPSYI MTEMQQRSNY SYNSHCQIPK AWDHHIIGSE GSSSVSEENG  240
VGNISEGMVV VEPVFIDFLG VGGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-32111127108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818460.0LN681846.1 Cucumis melo genomic scaffold, anchoredscaffold00009.
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138987.10.0PREDICTED: transcription factor MYB44
TrEMBLA0A0A0LHV60.0A0A0A0LHV6_CUCSA; Uncharacterized protein
STRINGPOPTR_0010s17470.17e-71(Populus trichocarpa)
STRINGBra016285.1-P3e-71(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.12e-72myb domain protein 117
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]